PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10006196m
Common NameEUTSA_v10006196mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28420.9 Da    PI: 9.211
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10006196mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65.1e-312473150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+
  Thhalv10006196m 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 73
                     79***********************************************8 PP

2K-box113.32.3e-37951887100
            K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       s++ea+++++qqe++kL+++i+ +q+++Rh++Ge+L+sL++keL++Le +Lek+++++RskK+ell+++ie++qk+e elq++n +Lr+k++e
  Thhalv10006196m  95 PSVTEANTQYYQQEASKLRRQIRDIQNSNRHIVGESLGSLNFKELKNLEGRLEKGISRVRSKKSELLVAEIEYMQKREMELQHDNLYLRAKIAE 188
                      45899**************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-391675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.3751676IPR002100Transcription factor, MADS-box
CDDcd002659.07E-441790No hitNo description
SuperFamilySSF554551.96E-321788IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-321838IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PfamPF003193.3E-262572IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-323853IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-325374IPR002100Transcription factor, MADS-box
PfamPF014866.3E-27100186IPR002487Transcription factor, K-box
PROSITE profilePS5129714.993102192IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MEEGGSSHDA DSSKKLGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
VIFSTRGRLY EYANNSVRGT IERYKKACSD AVNPPSVTEA NTQYYQQEAS KLRRQIRDIQ  120
NSNRHIVGES LGSLNFKELK NLEGRLEKGI SRVRSKKSEL LVAEIEYMQK REMELQHDNL  180
YLRAKIAEGA RLNQEQQESS VIQGTAVYES GVSSHDQTQH YNNRNYIPVN LLEPNQQFSG  240
QDQPPLQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-201684169Myocyte-specific enhancer factor 2B
1tqe_Q3e-201684169Myocyte-specific enhancer factor 2B
1tqe_R3e-201684169Myocyte-specific enhancer factor 2B
1tqe_S3e-201684169Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00093SELEXTransfer from AT3G58780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankATHAGL1A0.0M55550.1 Arabidopsis thaliana transcription factor (AGL1), complete cds.
GenBankAY0861960.0AY086196.1 Arabidopsis thaliana clone 22339 mRNA, complete sequence.
GenBankDQ6531590.0DQ653159.1 Arabidopsis thaliana clone 0000017184_0000012028 unknown mRNA.
GenBankJQ9730910.0JQ973091.1 Arabidopsis thaliana Shatterproof (SHP1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402748.10.0hypothetical protein EUTSA_v10006196mg
SwissprotP293811e-179AGL1_ARATH; Agamous-like MADS-box protein AGL1
TrEMBLV4NDT40.0V4NDT4_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.5__2325__AT3G58780.11e-174(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33412350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58780.11e-180MIKC_MADS family protein